Erratum to: Candidates of trichocyst matrix proteins of the dinoflagellate Oxyrrhis marina

Protoplasma, Aug 2017

Erhard Rhiel, Lars Wöhlbrand, Ralf Rabus, Sonja Voget

A PDF file should load here. If you do not see its contents the file may be temporarily unavailable at the journal website or you do not have a PDF plug-in installed and enabled in your browser.

Alternatively, you can download the file locally and open with any standalone PDF reader:

https://link.springer.com/content/pdf/10.1007%2Fs00709-017-1152-6.pdf

Erratum to: Candidates of trichocyst matrix proteins of the dinoflagellate Oxyrrhis marina

Erratum to: Candidates of trichocyst matrix proteins of the dinoflagellate Oxyrrhis marina Erhard Rhiel 0 1 2 Lars Wöhlbrand 0 1 2 Ralf Rabus 0 1 2 Sonja Voget 0 1 2 0 Stabsstelle Sicherheitswesen/Umweltschutz , Georg- 1 General and Molecular Microbiology, ICBM, Carl von Ossietzky University Oldenburg , P.O.B. 2503, 26129 Oldenburg , Germany 2 Planktology, ICBM, Carl von Ossietzky University Oldenburg , P.O.B. 2503, 26129 Oldenburg , Germany The published version contains mistake. Entries were incorrectly aligned in Table 1. Corrected table is shown below. - products of the ESTs of Oxyrrhis marina are shown. The entire amino acid sequences of the deduced translation products of the ESTs of Oxyrrhis marina and of the precursor and mature TMPs of Paramecium tetraurelia are compiled in Supplement II_Sequences CAMPEP sequences which fit to T2-A1 in the anterior continued T2-A1 CAMPEP_0190380732 CAMPEP_0190304660 CAMPEP_0190331188 CAMPEP_0190324578 RAEEHEDFEEKVLEHQEATAIIAEARRLFADNIEHGS-FIQ REKEHQDYAAVAAELQEAIDTIERGIAVLEREMPKGS-FMQ RKAEHKDFTERDQESVETIDTLERALQTIKKELAHGF-VQRTREHQDFETIQSDLKTAIGQLQRAVKIVESNFGSGDSFLQ RNNEAAQYASESGELKDSIAALAKAIPALKKGMENGS-FL* * :: : : : .. . : * . CAMPEP sequence which fits to T2-A1 in the posterior DPLDRLLSTLTDLEDRYVAEQKEDDAKNQEYQGACTVDISAFDKDLAESNRKKIELEARLEGQLYPQRSILEGLVAQKKAEVKGYQKDLDELDAQ NPIAKVLELLEGMRGKIVAEGEEEQATYEEYTGWCRKESKALKREVADAQAQVKELTATIEKATATIDE-LTEKTSDLAASITSAQNDLKDATAV SPISKVIQLLSSLESKVTSEGEKEQQQYEEFARWCEENAKEKQHELKNSAERKESLESTLEKTQADIST-TKAKIEELSSSISQNDADLEKATAV NPVSRVVEVLTSMKAEVEQQGQTDEEHYQKFSCWCTTNKQSKQNAISRAEDQSTQLQATVLENVATKSQ-LETEIGQLKKARATAKKSLDTATSL NPVRKVVDLLQKLGKEIEDETSKAKKMYNKYMCYCDTNTASLEKDIEEEKEHISELEANMKELSGQNAQ-LEAEIADAQESLEANKKTIAEATVM .*: :::. * : . : . . ::: * : .. : : .* : : : . : DPLDRLLSTLTDLEDRYVAEQKEDD---------------------------------------------------------------------HPLTKIVNLLKDMEAQLTADAKADKTTYEKLACWCKNTKESKVAAISTAQSRITDLTAAVQEYAASEAEADTNIKQLKKEVNQGENALAQARAGR .** :::. *.*:* : .*: * *. --------------------------------------------------------------------------------------------AKN EISAVQDAITILTEDSGSETMGRALSLLQVGAARAAALSREARGRVAGLLLAAAKRTGNADLLKLAGTVSLDTFTKIKAACEKMISELKQQQVDE ..: QEYQGACTVDISAFDKDLAESNRKKIELEARLEGQLYPQRSILEGLVAQKKAEVKGYQKDLDEL-------DAQRAEEHEDFEEKVLEHQEATAI VKQRDFCVSEFSTNEKETAAANRQKSELENKIED--------LESLIAKLTAEMEDLTKQIADVKLQVKQAGQNRESENADFQATINDQRQTQAI : : *. ::*: :*: * :**:* *** ::* **.*:*: .**:: *:: :: :* .*. **: .: ::::: ** IAEARR----LFAD--------NIEHGSFIQ LAKAITRLQVVYAKTQEERLAASGSAGALVQ :*:* ::*. . . *:::* LADAGAVQKIIDLADELLAKI------------------------------------------------------------ADSL---------AVQVTPLQKVVEMLEGMLAKGKEEKHDEVVRFNTFKQWCDDTNNAKRATVKDEKHSINKLTANIEKDTATIAHLDDELARLNDDLAAWQGDLKAA .:. :**:::: : :*** *.* -------------------------------------------SLLRF----------------------------------------------AGIRKKDNIDFMEQHKDYTTSIDQLQQAVESIKSHSHDAPQSSALLQLQNNKLIPTSAYRVLQAFLQTSDDGVPEANAYESQSGGVVEVLTELRR :**:: -AEDKRVE----------AYKKSRNFIVISLNVAGSALANATSDLASLNDIIAQVEASLDTTEQRIENVSADRHDRFTQCEEAVQDYQDARAART KFEDERLQLEKEEANAKFAYQQAQQGLSDNIEQAETELATKTQDMQKTKKRKAADEEELETTQKALAEDSAYLQDTENLCLEKAQAYENRQVTRA **:*:: **::::: : .:: * : **. *.*: . :. * * .*:**:: : : ** :* . * * .* *:: :.:*: SDRDVVSQTIGLVNKELRTLREQ----------LALRQQAGEEI GEIEAIEQALGILNSDAVKGNAEKHLPSLAQRGVALMQLRGESR .: :.:.*::*::*.: . . : :** * **. DPLDRLVSTLTDLEDRYVAEQKEDDAKNQEYQGACTVDITAFDKDLAESNRKKIELEARLEGQLYPQRSILEGLVAQKKAEVKGYQKDLDELDAQ NPVSRVVEVLTSMKAEVEQQGQTDEEHYQKFSCWCTTNKQSKQNAISRAEDQSTQLQATVLENVATKS-QLETEIGQLKKARATAKKSLDTATSL NPIAKVLELLEGMRGKIVAEGEEEQATYEEYTGWCRKESKALKREVADAQAQVKELTATIEKATATIDELTE-KTSDLAASITSAQNDLKDATAV :*: :::. * :. . : : :: ::: * : : .. :: :: : :* * : * .: ::.*. : RAEEHEDFEEKVLEHQEATAIIAEARRLFADNIEHE-SFVQ RTREHQDFETIQSDLKTAIGQLQRAVKIVESNFGSGDSFLQ REKEHQDYAAVAAELQEAIDTIERGIAVLEREMPKG-SFMQ * .**:*: : : * : .. :. :: **:* Candidates of trichocyst matrix proteins of the dinoflagellate Oxyrrhis marina QSQHDTWVRKDAEHVDQMEAIDEASKIVQHLQAGVAFAQLKS TAQHNDWVNRNAELSETIDTLSRALALVKKNVAGLTQVDVQA QKQHQEYLQTKNELEEAVGALDKAIRALAGA--GTGAG---NKEHASYVQTKNEMEEAIGALEKAINSLSGA--GMNTGSLIS :* ::. . * : : ::..* : * CAMPEP sequences which fit to T4-A1 in the posterior part T4-A1 GPVGEIQILLNNIASQLNGDQKKADKVHESDTVAFEKIIAD-------LEQEIAYHQTQIVALSNLRDSTTEALGEAEVEVRVVTSDIANNEKSF CAMPEP_0190384136 SPVTKVIELLGSLAAKVTKEG-------DEEGRQYDQFVEWCEDNAKSLQHELSNAESRKEELAASIEKSESDIEEAETEIGELSESIAEAEKDL CAMPEP_0190304688 NPISKVIDLIGSLKSKVVQEG-------VTEQESYEKFAKWCKAEATQKQYEIRDGQNSVEQLSATIEKADATIQELDARIAKLTTTISTNENDL CAMPEP_0190302652 NPISKVLELLHGLREKVVTEG-------EAEQVGYEKFAKWCKDESTQKKFEIEDGRNQVDSLTATIEKATASIQELDSKIEKLTAAVNQNEADL CAMPEP_0190319222 NPISKVLDLLSGLRSKVVADG-------ETEQKSYEEFAKWCKTESTEKKFEIEDGRNQVDSLTATIEKASATISELDSKIEKLTTAVNQNEKDL *: :: *: : :: : : :::: : *: .. *: :.: : * : .: :: : * .: ADESATRQSQHDTWVRKDAEHVDQMEAIDEASKIVQHL-QAGVAFAQLKS ERATQVRTAQHNDWVNRNAELSETIDTLSRALALVKKNVAG----LTQVD GAAKDMRKKEHEDYSSNDKESVEVIDTLEKAIATLEKALKKGSTLVQVVN SAATEVRHKEHEDYLANDKELVEAIDTLQRAIAVLEKALKKGSSLIQAVA DAATTVRHTEHEDYLATDKEMVEAIDTLERAIGVLEKALKKGSSLIQAVK . * :*: : : * : ::::..* ::: NKSIIKILELLAQIRQQLVASRASLLATEERQAANWEVQSSHLQEEH----KRLVERKAFLENSIVQFKVTIQEAVEDLEDQTLFLEDAEDSLAI NAKSGKILGLLKQMQEGMEHEDEESTATEKAQAEAFAELKTTLKKEIATQTNKINDKTT----ALADTKVDLENSESDLEETQATLEADEKFLAD * . *** ** *::: : . . ***: ** : .: *::* ::: ::.: ::.: ** :::: .***: ** *. ** CAMPEP sequences which fit to T4-B1 in the posterior part T4-B1 GPVGEIQILLNNIASQLNGDQKKADKVHESDTVAFEKIIAD-------LEQEIAYHQTQIVALSNLRDSTTEALGEAEVEVRVVTSDIANNEKSFADESAT CAMPEP_0190384136 SPVTKVIELLGSLAAKVTKEG-------DEEGRQYDQFVEWCEDNAKSLQHELSNAESRKEELAASIEKSESDIEEAETEIGELSESIAEAEKDLERATQV CAMPEP_0190304688 NPISKVIDLIGSLKSKVVQEG-------VTEQESYEKFAKWCKAEATQKQYEIRDGQNSVEQLSATIEKADATIQELDARIAKLTTTISTNENDLGAAKDM CAMPEP_0190302652 NPISKVLELLHGLREKVVTEG-------EAEQVGYEKFAKWCKDESTQKKFEIEDGRNQVDSLTATIEKATASIQELDSKIEKLTAAVNQNEADLSAATEV CAMPEP_0190319222 NPISKVLDLLSGLRSKVVADG-------ETEQKSYEEFAKWCKTESTEKKFEIEDGRNQVDSLTATIEKASATISELDSKIEKLTTAVNQNEKDLDAATTV *: :: *: : :: : : :::: : *: .. *: :.: : * : .: :: : * .: . continued T4-B1 RQSQHDTWVRKDAEHVDQMEAIDEASKIVQHL-QAGVAFAQLKS CAMPEP_0190384136 RTAQHNDWVNRNAELSETIDTLSRALALVKKNVAG----LTQVD CAMPEP_0190304688 RKKEHEDYSSNDKESVEVIDTLEKAIATLEKALKKGSTLVQVVN CAMPEP_0190302652 RHKEHEDYLANDKELVEAIDTLQRAIAVLEKALKKGSSLIQAVA CAMPEP_0190319222 RHTEHEDYLATDKEMVEAIDTLERAIGVLEKALKKGSSLIQAVK * :*: : : * : ::::..* ::: T4-B2 CAMPEP_0190329298


This is a preview of a remote PDF: https://link.springer.com/content/pdf/10.1007%2Fs00709-017-1152-6.pdf

Erhard Rhiel, Lars Wöhlbrand, Ralf Rabus, Sonja Voget. Erratum to: Candidates of trichocyst matrix proteins of the dinoflagellate Oxyrrhis marina, Protoplasma, 2017, 1-4, DOI: 10.1007/s00709-017-1152-6